discontinued

H00005650-B01 KLK7 / Kallikrein-7 antibody

See related secondary antibodies

Search for all "KLK7 / Kallikrein-7"

Quick Overview

Mouse anti Human KLK7 / Kallikrein-7

Product Description for KLK7 / Kallikrein-7

Mouse anti Human KLK7 / Kallikrein-7.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for KLK7 / Kallikrein-7

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms PRSS6, SCCE, Serine protease 6, Stratum corneum chymotryptic enzyme, hK7
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P49862
Immunogen:
KLK7 (AAH32005, 1 a.a. ~ 254 a.a) full-length human protein.
AA Sequence:
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEY TVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTT TSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQ PNDPGVYTQVCKFTKWINDTMKKHR*
GeneID:
5650
Remarks:
Gene Accession: BC032005
Add. information Mouse polyclonal antibody raised against a full-length human KLK7 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 5650

Accessory Products

Proteins and/or Positive Controls

Proteins for KLK7 / Kallikrein-7 (9 products)

Catalog No. Species Pres. Purity   Source  

KLK7 / Kallikrein-7 (transcript variant 1)

KLK7 / Kallikrein-7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

KLK7 / Kallikrein-7 (transcript variant 1)

KLK7 / Kallikrein-7 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €399.00
  OriGene Technologies, Inc.

KLK7 / Kallikrein-7 (30-253, His-tag)

KLK7 / Kallikrein-7 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

KLK7 / Kallikrein-7 (30-253, His-tag)

KLK7 / Kallikrein-7 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KLK7 / Kallikrein-7 (2 products)

Catalog No. Species Pres. Purity   Source  

Kallikrein-7 / KLK7 Lysate(Denatured)

Kallikrein-7 / KLK7 Lysate(Denatured)
  Abnova Taiwan Corp.

Kallikrein-7 / KLK7 Lysate(Denatured)

Kallikrein-7 / KLK7 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn