TA341708 Klotho antibody

Rabbit Polyclonal Anti-KL Antibody

See related secondary antibodies

Search for all "Klotho"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Klotho

Product Description for Klotho

Rabbit anti Human Klotho.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Klotho

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms EC 3.2.1.31, KL, Klotho
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UEF7-2
Immunogen:
The immunogen for anti-KL antibody: synthetic peptide directed towards the n terminal of human KL. Synthetic peptide located within the following region: FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP.
GeneID:
9365
Application WB
Background This gene encodes a type-I membrane protein that is related to beta-glucosidases. Reduced production ofThis protein has been observed in patients with chronic rel failure (CRF), andThis may be one ofThe factors underlyingThe degenerative processes (e.g., arteriosclerosis, osteoporosis, and skin atrophy) seen in CRF. Also, mutations withinThis protein have been associated with ageing and bone loss. [provided by RefSeq, Jul 2008].
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn