
NBP1-59032 KLRA1 antibody

See related secondary antibodies

Search for all "KLRA1"

Quick Overview

Rabbit anti Human KLRA1

Product Description for KLRA1

Rabbit anti Human KLRA1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for KLRA1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KLRA#, LY49L, Ly-49L, Ly49, MGC126520, MGC126522
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to KLRA1(killer cell lectin-like receptor subfamily A, member 1) The peptide sequence was selected from the N terminal of KLRA1. Peptide sequence NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL.
Background The function of the KLRA1 protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn