NBP1-59032 KLRA1 antibody

See related secondary antibodies

Search for all "KLRA1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KLRA1

Product Description for KLRA1

Rabbit anti Human KLRA1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for KLRA1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KLRA#, LY49L, Ly-49L, Ly49, MGC126520, MGC126522
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to KLRA1(killer cell lectin-like receptor subfamily A, member 1) The peptide sequence was selected from the N terminal of KLRA1. Peptide sequence NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL.
Background The function of the KLRA1 protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn