H00148930-B01P KNCN antibody

See related secondary antibodies

Search for all "KNCN"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KNCN

H00148930-B01P

Product Description for KNCN

Mouse anti Human KNCN.
Product is tested for Western blot / Immunoblot.

Properties for KNCN

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ32011, Kino, L5, MGC120370, MGC120371, MGC120372
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6PVL3
Immunogen:
KNCN (AAI01297.1, 1 a.a. ~ 136 a.a) full-length human protein.
AA Sequence:
MLRQSLSGCPCPALPSCLLPLCQCPPGLGDPDRRQARPCRPQSGWEQCLEWGLLHSPGQASPKWIPLVWAGTWSKV SPDAPTGFPCFRLLPWPFFLDCSSALLPVQSTDLFLWNLGSRALTMTRMPQSLALTRLQK
GeneID:
148930
Add. information Mouse polyclonal antibody raised against a full-length human KNCN protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for KNCN (1 products)

Catalog No. Species Pres. Purity   Source  

KNCN overexpression lysate

KNCN overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn