discontinued

H00003836-M01 KPNA1 / Importin alpha-1 antibody

See related secondary antibodies

Search for all "KPNA1 / Importin alpha-1"

Quick Overview

Mouse anti Human KPNA1 / Importin alpha-1 2A4-1B5

H00003836-M01

More Views

  • H00003836-M01
  • H00003836-M01

Product Description for KPNA1 / Importin alpha-1

Mouse anti Human KPNA1 / Importin alpha-1 2A4-1B5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for KPNA1 / Importin alpha-1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms IPOA5, Karyopherin alpha 1, NPI-1, Nucleoprotein interactor 1, RAG cohort protein 2, RCH2, SRP1, SRP1-beta
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 2A4-1B5
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P52294
Immunogen:
KPNA1 (AAH02374, 1 a.a. ~ 539 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNME MAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLT NIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTM TRNAVWALSNLCRGKSPPPEFAKVSPC
GeneID:
3836
Remarks:
Gene Accession: BC002374
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant KPNA1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3836

Accessory Products

Proteins and/or Positive Controls

Proteins for KPNA1 / Importin alpha-1 (3 products)

Catalog No. Species Pres. Purity   Source  

KPNA1 / Importin alpha-1 (transcript variant 1)

KPNA1 / Importin alpha-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

KPNA1 / Importin alpha-1

KPNA1 / Importin alpha-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA1 / Importin alpha-1

KPNA1 / Importin alpha-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KPNA1 / Importin alpha-1 (2 products)

Catalog No. Species Pres. Purity   Source  

KPNA1 293T Cell Transient Overexpression Lysate(Denatured)

KPNA1 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-KPNA1 antibody (H00003836-B01) by Western Blots.
  Abnova Taiwan Corp.

SRP1 Lysate

Western Blot: SRP1 Lysate [NBL1-12369] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KPNA1
  Novus Biologicals Inc.
  • LinkedIn