TA335049 KPNA1 / Importin alpha-1 antibody

Rabbit Polyclonal Anti-KPNA1 Antibody

See related secondary antibodies

Search for all "KPNA1 / Importin alpha-1"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KPNA1 / Importin alpha-1


More Views

  • TA335049

Product Description for KPNA1 / Importin alpha-1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KPNA1 / Importin alpha-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KPNA1 / Importin alpha-1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IPOA5, Karyopherin alpha 1, NPI-1, Nucleoprotein interactor 1, RAG cohort protein 2, RCH2, SRP1, SRP1-beta
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KPNA1 antibody: synthetic peptide directed towards the N terminal of human KPNA1. Synthetic peptide located within the following region: TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA.
Application WB
Background Recombition activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombition, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombition process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-D break repair. KP1 interacts with RAG1 and may play a role in V(D)J recombition.Recombition activating proteins RAG1 and RAG2 regulate and mediate V(D)J recombition, the process by which genes for immunoglobulins and T-cell receptors are generated. Several other ubiquitously expressed proteins are thought to be recruited in the recombition process. Among these are the genes affected in severe combined immune deficiency and genes involved in ds-D break repair. The protein encoded by this gene interacts with RAG1 and may play a role in V(D)J recombition. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for KPNA1 / Importin alpha-1 (3 products)

Catalog No. Species Pres. Purity   Source  

KPNA1 / Importin alpha-1 (transcript variant 1)

KPNA1 / Importin alpha-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

KPNA1 / Importin alpha-1

KPNA1 / Importin alpha-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA1 / Importin alpha-1

KPNA1 / Importin alpha-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KPNA1 / Importin alpha-1 (2 products)

Catalog No. Species Pres. Purity   Source  

KPNA1 293T Cell Transient Overexpression Lysate(Denatured)

KPNA1 293T Cell Transient Overexpression Lysate(Denatured) Transient overexpression cell lysate was tested with Anti-KPNA1 antibody (H00003836-B01) by Western Blots.
  Abnova Taiwan Corp.

SRP1 Lysate

Western Blot: SRP1 Lysate [NBL1-12369] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KPNA1
  Novus Biologicals Inc.
  • LinkedIn