TA335051 KPNA2 / Importin alpha-2 antibody

Rabbit Polyclonal Anti-KPNA2 Antibody

See related secondary antibodies

Search for all "KPNA2 / Importin alpha-2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KPNA2 / Importin alpha-2

Product Description for KPNA2 / Importin alpha-2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KPNA2 / Importin alpha-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KPNA2 / Importin alpha-2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Karyopherin alpha-2, RAG cohort protein 1, RCH1, SRP1-alpha
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KPNA2 antibody: synthetic peptide directed towards the middle region of human KPNA2. Synthetic peptide located within the following region: GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ.
Application WB
Background Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of R polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KP2 protein interacts with the NLSs of D helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KP2 also may play a role in V(D)J recombition.The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of R polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KP2 protein interacts with the NLSs of D helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KP2 also may play a role in V(D)J recombition. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for KPNA2 / Importin alpha-2 (10 products)

Catalog No. Species Pres. Purity   Source  

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

KPNA2 / Importin alpha-2 (1-529, His-tag)

KPNA2 / Importin alpha-2 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €730.00
  OriGene Technologies GmbH

KPNA2 / Importin alpha-2 (1-529, His-tag)

KPNA2 / Importin alpha-2 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €300.00
  OriGene Technologies GmbH

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human Purified 95 % E. coli
  GenWay Biotech Inc.

KPNA2 / Importin alpha-2

KPNA2 / Importin alpha-2 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for KPNA2 / Importin alpha-2 (2 products)

Catalog No. Species Pres. Purity   Source  

Importin subunit alpha-2 Lysate(Denatured)

Importin subunit alpha-2 Lysate(Denatured)
  Abnova Taiwan Corp.

KPNA2 Lysate

Western Blot: KPNA2 Lysate [NBL1-12370] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KPNA2
  Novus Biologicals Inc.
  • LinkedIn