discontinued

H00003839-A01 KPNA3 / Importin alpha-3 antibody

See related secondary antibodies

Search for all "KPNA3 / Importin alpha-3"

Quick Overview

Mouse anti Human KPNA3 / Importin alpha-3

Product Description for KPNA3 / Importin alpha-3

Mouse anti Human KPNA3 / Importin alpha-3.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for KPNA3 / Importin alpha-3

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Importin alpha Q2, Karyopherin subunit alpha-3, QIP2, SRP1-gamma
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O00505
Immunogen:
KPNA3 (NP_002258, 422 a.a. ~ 522 a.a) partial recombinant protein with GST tag.
AA Sequence:
VKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLI PEATQGGTYNFDPTANLQTKEFNF*
GeneID:
3839
Remarks:
Gene Accession: NM_002267
Add. information Mouse polyclonal antibody raised against a partial recombinant KPNA3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 3839

Accessory Products

Proteins and/or Positive Controls

Proteins for KPNA3 / Importin alpha-3 (3 products)

Catalog No. Species Pres. Purity   Source  

KPNA3 / Importin alpha-3

KPNA3 / Importin alpha-3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

KPNA3 / Importin alpha-3

KPNA3 / Importin alpha-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA3 / Importin alpha-3

KPNA3 / Importin alpha-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KPNA3 / Importin alpha-3 (1 products)

Catalog No. Species Pres. Purity   Source  

KPNA3 Lysate

Western Blot: KPNA3 Lysate [NBL1-12371] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for KPNA3.
  Novus Biologicals Inc.
  • LinkedIn