TA335052 KPNA3 / Importin alpha-3 antibody

Rabbit Polyclonal Anti-KPNA3 Antibody

See related secondary antibodies

Search for all "KPNA3 / Importin alpha-3"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish KPNA3 / Importin alpha-3


More Views

  • TA335052
  • TA335052
  • TA335052
  • TA335052

Product Description for KPNA3 / Importin alpha-3

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish KPNA3 / Importin alpha-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KPNA3 / Importin alpha-3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Importin alpha Q2, Karyopherin subunit alpha-3, QIP2, SRP1-gamma
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-KPNA3 antibody: synthetic peptide directed towards the N terminal of human KPNA3. Synthetic peptide located within the following region: AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV.
Application WB
Background The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization sigls (NLSs). KP3 is a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KP2), respectively. The similarities among these proteins suggest that karyopherin alpha-3 may be involved in the nuclear transport system.The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization sigls (NLSs). KP3, encodes a protein similar to certain nuclear transport proteins of Xenopus and human. The predicted amino acid sequence shows similarity to Xenopus importin, yeast SRP1, and human RCH1 (KP2), respectively. The similarities among these proteins suggests that karyopherin alpha-3 may be involved in the nuclear transport system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for KPNA3 / Importin alpha-3 (3 products)

Catalog No. Species Pres. Purity   Source  

KPNA3 / Importin alpha-3

KPNA3 / Importin alpha-3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

KPNA3 / Importin alpha-3

KPNA3 / Importin alpha-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KPNA3 / Importin alpha-3

KPNA3 / Importin alpha-3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KPNA3 / Importin alpha-3 (1 products)

Catalog No. Species Pres. Purity   Source  

KPNA3 Lysate

Western Blot: KPNA3 Lysate [NBL1-12371] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for KPNA3.
  Novus Biologicals Inc.
  • LinkedIn