H00065095-B01P KRI1 antibody

See related secondary antibodies

Search for all "KRI1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KRI1

H00065095-B01P

Product Description for KRI1

Mouse anti Human KRI1.
Product is tested for Western blot / Immunoblot.

Properties for KRI1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ12949
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N9T8
Immunogen:
KRI1 (AAI66660.1, 1 a.a. ~ 709 a.a) full-length human protein.
AA Sequence:
MGHRTAMPEPRGSSQLRVNAAFAARYNRYREREELQRLKDRYGDRDSSSDSSSESDSSDERVEFDPQQERDFYKTL SLLKKKDPRIYQKDATFYNRTASSSDSEEDPEALEKQKKVRPMYLKDYERKVILEKAGKYVDEENSDGETSNHRLQ ETSSQSYVEEQKQLKESFRAFVEDSEDEDGAGEGGSSLLQKRAKTRQEKAQEEADYIEWLKGQKEIRNPDSLKELT HLKEYWNDPELDEGERFLRDYILNKRYEEEEEEEEDEEEMEEEEGVHGPPVQLAVDDSSDEGELFLKKQEDFEQKY NFRFEEPDSASVKTYPRSIASSVRRKDERRKEKREETRERKKREKAKKQEELKQLKNLKRKEILAKLEKLRKVTGN EMLGLEEGDLEDDFDPAQHDQLMQKCFGDEYYGAVEEEKPQFEEEEGLEDDWNWDTWDGPEQEGDWSQQELHCEDP NFNMDADYDPSQPRKKKREAPLTGKKKRKSPFAAAVGQEKPVFEPGDKTFEEYLDEYYRLDYEDIIDDLPCRFKYR TVVPCDFGLSTEEILAADDKELNRWCSLKKTCMYRSEQEELRDKRAYSQKAQNSWKKRQVFKSLCREEAETPAEAT GKPQRDEAGPQRQLPALDGSLMGPESPPAQEEEAPVSPHKKPAPQKRRRAKKARLLGPTVMLGGCEFSRQRLQAFG LNPKRLHFRQLGRQRRKQQGPKNSS
GeneID:
65095
Add. information Mouse polyclonal antibody raised against a full-length human KRI1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn