H00125115-B01P KRT40 antibody

See related secondary antibodies

Search for all "KRT40"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KRT40

H00125115-B01P

Product Description for KRT40

Mouse anti Human KRT40.
Product is tested for Western blot / Immunoblot.

Properties for KRT40

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ36600, KA36
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6A162
Immunogen:
KRT40 (ADR83001.1, 1 a.a. ~ 431 a.a) full-length human protein.
AA Sequence:
MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLLPCYFTGSCNSPCLVGN CAWCEDGVFTSNEKETMQFLNDRLASYLEKVRSLEETNAELESRIQEQCEQDIPMVCPDYQRYFNTIEDLQQKILC TKAENSRLAVQLDNCKLATDDFKSKYESELSLRQLLEADISSLHGILEELTLCKSDLEAHVESLKEDLLCLKKNHE EEVNLLREQLGDRLSVELDTAPTLDLNRVLDEMRCQCETVLANNRREAEEWLAVQTEELNQQQLSSAEQLQGCQME ILELKRTASALEIELQAQQSLTESLECTVAETEAQYSSQLAQIQCLIDNLENQLAEIRCDLERQNQEYQVLLDVKA RLEGEINTYWGLLDSEDSRLSCSPCSTTCTSSNTCEPCSAYVICTVENCCL
GeneID:
125115
Add. information Mouse polyclonal antibody raised against a full-length human KRT40 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for KRT40 (1 products)

Catalog No. Species Pres. Purity   Source  

KRT40 overexpression lysate

KRT40 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn