H00085289-B01P KRTAP4-5 antibody

See related secondary antibodies

Search for all "KRTAP4-5"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KRTAP4-5

H00085289-B01P

Product Description for KRTAP4-5

Mouse anti Human KRTAP4-5.
Product is tested for Western blot / Immunoblot.

Properties for KRTAP4-5

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms KAP4.5, KRTAP4.5
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYR2
Immunogen:
KRTAP4-5 (AAI60148.1, 1 a.a. ~ 181 a.a) full-length human protein.
AA Sequence:
MVSSCCGSVSSEQSCGLENCCRPSCCQTTCCRTTCCRPSCCKPQCCQSVCYQPTCCHPSCCISSCCRPYCCESSCC RPCCCQTTCCRTTCCRTTCCCPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSCCHPSCCESSCCRPCCCVRPVCG RVSCHTTCYRPTCVISTCPRPLCCASSCC
GeneID:
85289
Add. information Mouse polyclonal antibody raised against a full-length human KRTAP4-5 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn