H00440051-B01P KRTAP5-11 antibody

See related secondary antibodies

Search for all "KRTAP5-11"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human KRTAP5-11

H00440051-B01P

Product Description for KRTAP5-11

Mouse anti Human KRTAP5-11.
Product is tested for Western blot / Immunoblot.

Properties for KRTAP5-11

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms KRTAP5-5, KRTAP5-6, KRTAP5.11
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6L8G4
Immunogen:
KRTAP5-11 (AAI48464.1, 1 a.a. ~ 156 a.a) full-length human protein.
AA Sequence:
MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGSSKGG CGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCC QCKI
GeneID:
440051
Add. information Mouse polyclonal antibody raised against a full-length human KRTAP5-11 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn