TA337405 KRTCAP2 / KCP2 antibody

Rabbit Polyclonal Anti-KRTCAP2 Antibody

See related secondary antibodies

Search for all "KRTCAP2 / KCP2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KRTCAP2 / KCP2

Product Description for KRTCAP2 / KCP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KRTCAP2 / KCP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KRTCAP2 / KCP2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KCP-2, Keratinocyte-associated protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6L1
Immunogen:
The immunogen for Anti-KRTCAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human KRTCAP2. Synthetic peptide located within the following region: GLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN.
GeneID:
200185
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KRTCAP2 / KCP2 (2 products)

Catalog No. Species Pres. Purity   Source  

KRTCAP2 / KCP2

KRTCAP2 / KCP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KRTCAP2 / KCP2

KRTCAP2 / KCP2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KRTCAP2 / KCP2 (1 products)

Catalog No. Species Pres. Purity   Source  

KRTCAP2 overexpression lysate

KRTCAP2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn