discontinued

H00091133-B01 L3MBTL4 antibody

See related secondary antibodies

Search for all "L3MBTL4"

Quick Overview

Mouse anti Human L3MBTL4

Product Description for L3MBTL4

Mouse anti Human L3MBTL4.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for L3MBTL4

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms H-l 3 mbt-like protein, L 3 mbt-like 4 protein, L3MBTL4, Lethal 3 malignant brain tumor-like 4 protein
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NA19
Immunogen:
L3MBTL4 (NP_775735.1, 1 a.a. ~ 534 a.a) full-length human protein.
AA Sequence:
MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQS FPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKHELHIP KGYRKDKFVWMDYLKACKLQNAPKKLFRNRSPNGPMSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDN WDDSYDYWCDVNSPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFLPNMKLEV VDKRNPRLIRVATIVDVDDQRVKVHFDGWDHKYDYWVEADSPDIHPIGWCDVTGHPLEVPQRTNDLKILPGQAVCP TPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESDSSHSKSKSLCSLNFNGKHEKVNSQ PRLVQQAKCLKIKGKEDIDLDNLFRGRVRWLMPVIPALWEAEAGRSRDQEIKTILANAVKPRLYQKYKKLARRGGG CL
GeneID:
91133
Remarks:
Gene Accession: NM_173464.1
Add. information Mouse polyclonal antibody raised against a full-length human L3MBTL4 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 91133

Accessory Products

Proteins and/or Positive Controls

Proteins for L3MBTL4 (2 products)

Catalog No. Species Pres. Purity   Source  

L3MBTL4

L3MBTL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

L3MBTL4

L3MBTL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for L3MBTL4 (2 products)

Catalog No. Species Pres. Purity   Source  

L3MBTL4 Lysate(Denatured)

L3MBTL4 Lysate(Denatured)
  Abnova Taiwan Corp.

L3MBTL4 overexpression lysate

L3MBTL4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn