discontinued

H00091133-M01 L3MBTL4 antibody

See related secondary antibodies

Search for all "L3MBTL4"

Quick Overview

Mouse anti Human L3MBTL4 1B9-1C12

Product Description for L3MBTL4

Mouse anti Human L3MBTL4 1B9-1C12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for L3MBTL4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms H-l 3 mbt-like protein, L 3 mbt-like 4 protein, L3MBTL4, Lethal 3 malignant brain tumor-like 4 protein
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1B9-1C12
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NA19
Immunogen:
L3MBTL4 (AAH39316, 1 a.a. ~ 535 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQS FPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKHELHIP KGYRKDKFVWMDYLKACKLQNAPKKLFRNRSPNGPMSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDN WDDSYDYWCDVNSPYVQPVGWCQENGR
GeneID:
91133
Remarks:
Gene Accession: BC039316
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant L3MBTL4.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 91133

Accessory Products

Proteins and/or Positive Controls

Proteins for L3MBTL4 (2 products)

Catalog No. Species Pres. Purity   Source  

L3MBTL4

L3MBTL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

L3MBTL4

L3MBTL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for L3MBTL4 (2 products)

Catalog No. Species Pres. Purity   Source  

L3MBTL4 Lysate(Denatured)

L3MBTL4 Lysate(Denatured)
  Abnova Taiwan Corp.

L3MBTL4 overexpression lysate

L3MBTL4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn