TA341512 L3MBTL4 antibody

Rabbit Polyclonal Anti-L3MBTL4 Antibody

See related secondary antibodies

Search for all "L3MBTL4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rabbit, Rat L3MBTL4

Product Description for L3MBTL4

Rabbit anti Canine, Human, Mouse, Rabbit, Rat L3MBTL4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for L3MBTL4

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms H-l 3 mbt-like protein, L 3 mbt-like 4 protein, L3MBTL4, Lethal 3 malignant brain tumor-like 4 protein
Presentation Purified
Reactivity Can, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-L3MBTL4 antibody: synthetic peptide directed towards the N terminal of human L3MBTL4. Synthetic peptide located within the following region: STTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQ.
Application WB
Background Putative Polycomb group (PcG) protein. PcG proteins maintainThe transcriptiolly repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for L3MBTL4 (2 products)

Catalog No. Species Pres. Purity   Source  


L3MBTL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


L3MBTL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for L3MBTL4 (2 products)

Catalog No. Species Pres. Purity   Source  

L3MBTL4 Lysate(Denatured)

L3MBTL4 Lysate(Denatured)
  Abnova Taiwan Corp.

L3MBTL4 overexpression lysate

L3MBTL4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn