discontinued

NBP1-59347 LCLAT1 antibody

See related secondary antibodies

Search for all "LCLAT1"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Porcine, Rat LCLAT1

Product Description for LCLAT1

Rabbit anti Human, Mouse, Porcine, Rat LCLAT1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LCLAT1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4DYR5
Immunogen:
Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of LYCAT. Peptide sequence YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE.
Background LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn