
NBP1-58052 LCN12 antibody

See related secondary antibodies

Search for all "LCN12"

50 µg / €440.00

Quick Overview

Rabbit anti Human LCN12

Product Description for LCN12

Rabbit anti Human LCN12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LCN12

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG.
Background LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn