NBP1-58052 LCN12 antibody

See related secondary antibodies

Search for all "LCN12"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LCN12

Product Description for LCN12

Rabbit anti Human LCN12.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LCN12

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IW14
Immunogen:
Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG.
Background LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn