NBP1-81316 LEAP2 antibody

See related secondary antibodies

Search for all "LEAP2"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LEAP2

Product Description for LEAP2

Rabbit anti Human LEAP2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for LEAP2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969E1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
GeneID:
116842
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 116842

Accessory Products

Proteins and/or Positive Controls

Proteins for LEAP2 (2 products)

Catalog No. Species Pres. Purity   Source  

LEAP2

LEAP2 Human
2 µg / €300.00
  Abnova Taiwan Corp.

Liver expressed antimicrobial peptide 2 (LEAP2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag)

Liver expressed antimicrobial peptide 2 (LEAP2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for LEAP2 (2 products)

Catalog No. Species Pres. Purity   Source  

LEAP2 Lysate

Western Blot: LEAP2 Lysate [NBL1-12481] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LEAP2.
0.1 mg / €400.00
  Novus Biologicals Inc.

LEAP2 overexpression lysate

LEAP2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn