discontinued

NBP1-81316 LEAP2 antibody

See related secondary antibodies

Search for all "LEAP2"

Quick Overview

Rabbit anti Human LEAP2

Product Description for LEAP2

Rabbit anti Human LEAP2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for LEAP2

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q969E1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
GeneID:
116842
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 116842

Accessory Products

Proteins and/or Positive Controls

Proteins for LEAP2 (2 products)

Catalog No. Species Pres. Purity   Source  

LEAP2

LEAP2 Human
  Abnova Taiwan Corp.

Liver expressed antimicrobial peptide 2 (LEAP2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug (full length, N-term HIS tag)

Liver expressed antimicrobial peptide 2 (LEAP2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for LEAP2 (2 products)

Catalog No. Species Pres. Purity   Source  

LEAP2 Lysate

Western Blot: LEAP2 Lysate [NBL1-12481] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LEAP2.
  Novus Biologicals Inc.

LEAP2 overexpression lysate

LEAP2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn