NBP1-92069 LENEP antibody

See related secondary antibodies

Search for all "LENEP"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LENEP

Product Description for LENEP

Rabbit anti Human LENEP.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for LENEP

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5L5
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD
GeneID:
55891
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 55891

Accessory Products

Proteins and/or Positive Controls

Positive controls for LENEP (1 products)

Catalog No. Species Pres. Purity   Source  

LENEP overexpression lysate

LENEP overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn