TA333448 LINGO2 antibody

Rabbit Polyclonal Anti-Lingo2 Antibody

See related secondary antibodies

Search for all "LINGO2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish LINGO2

Product Description for LINGO2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish LINGO2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LINGO2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms LERN3, LRRN6C, Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2, Leucine-rich repeat neuronal protein 3, Leucine-rich repeat neuronal protein 6C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Lingo2 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lingo2. Synthetic peptide located within the following region: KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn