TA339883 Lipocalin-6 antibody

Rabbit Polyclonal Anti-LCN6 Antibody

See related secondary antibodies

Search for all "Lipocalin-6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human Lipocalin-6

Product Description for Lipocalin-6

Rabbit anti Canine, Human Lipocalin-6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Lipocalin-6

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Epididymal-specific lipocalin-6, LCN5, LCN6, Lipocalin-5
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-LCN6 antibody: synthetic peptide directed towards the middle region of human LCN6. Synthetic peptide located within the following region: LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR.
Application WB
Background LCN6 may play a role in male fertility.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Lipocalin-6 (1 products)

Catalog No. Species Pres. Purity   Source  


Lipocalin-6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Lipocalin-6 (1 products)

Catalog No. Species Pres. Purity   Source  

LCN6 Lysate

Western Blot: LCN6 Lysate [NBL1-12464] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for LCN6.
  Novus Biologicals Inc.
  • LinkedIn