TA337817 LIX1L antibody

Rabbit Polyclonal Anti-LIX1L Antibody

See related secondary antibodies

Search for all "LIX1L"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LIX1L

Product Description for LIX1L

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish LIX1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LIX1L

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms LIX1-like protein
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVB5
Immunogen:
The immunogen for anti-LIX1L antibody: synthetic peptide directed towards the N terminal of human LIX1L. Synthetic peptide located within the following region: AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN.
GeneID:
128077
Application WB
Background The exact functions of LIX1L remain unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LIX1L (1 products)

Catalog No. Species Pres. Purity   Source  

LIX1L

LIX1L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn