H00084298-B01P LLPH antibody

See related secondary antibodies

Search for all "LLPH"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LLPH

H00084298-B01P

Product Description for LLPH

Mouse anti Human LLPH.
Product is tested for Western blot / Immunoblot.

Properties for LLPH

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C12orf31, MGC104302, MGC14817, hLLP
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BRT6
Immunogen:
LLPH (NP_115714.1, 1 a.a. ~ 129 a.a) full-length human protein.
AA Sequence:
MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEKDDMKME TDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKGLAW
GeneID:
84298
Add. information Mouse polyclonal antibody raised against a full-length human LLPH protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn