H00150786-B01P LOC150786 antibody

See related secondary antibodies

Search for all "LOC150786"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC150786

H00150786-B01P

Product Description for LOC150786

Mouse anti Human LOC150786.
Product is tested for Western blot / Immunoblot.

Properties for LOC150786

Product Category Primary Antibodies
Quantity 50 µg
Synonyms WTH3DI
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53S08
Immunogen:
LOC150786 (AAI53206.1, 1 a.a. ~ 254 a.a) full-length human protein.
AA Sequence:
MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTAGQERLR SLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVIITLVGNKTDLADKRQVSIEEGERKAKGLNVTF IETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSFIDC SVNIGLNLFPSLITFCNSSLLPVSWR
GeneID:
150786
Add. information Mouse polyclonal antibody raised against a full-length human LOC150786 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for LOC150786 (1 products)

Catalog No. Species Pres. Purity   Source  

WTH3DI overexpression lysate

WTH3DI overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn