H00283155-A01 LOC283155 antibody

See related secondary antibodies

Search for all "LOC283155"

50 µl / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC283155

H00283155-A01

Product Description for LOC283155

Mouse anti Human LOC283155.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for LOC283155

Product Category Primary Antibodies
Quantity 50 µl
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC283155 (XP_208545, 207 a.a. ~ 298 a.a) partial recombinant protein with GST tag.
AA Sequence:
RRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRI KKMLAKMVESQDVKI*
Remarks:
Gene Accession: XM_208545
Add. information Mouse polyclonal antibody raised against a partial recombinant LOC283155.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
Purity:
Antibody Reactive Against Recombinant Protein.
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn