H00283970-B01 LOC283970 MaxPab mouse antibody

See related secondary antibodies

Search for all "LOC283970 MaxPab mouse"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC283970 MaxPab mouse

Product Description for LOC283970 MaxPab mouse

Mouse anti Human LOC283970 MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LOC283970 MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -, hypothetical protein LOC283970
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC283970 (AAH63633, 1 a.a. ~ 412 a.a) full-length human protein.
AA Sequence:
MVSILQLVQNLMHGDEDEEPQSPRIQNIGEQGHVAVLGHSLGAYILTLDEEKLRKLTTRILSDTTLWLCRIFRYEN GCAYFHEEEREGLAKICRLAIHSQYEDFVVDGFSGLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTM FGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSS VLAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDPALTLVAGLISNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQ LSQWLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSAVGRERHSCDALNLWLGEQLKQ LVPASGLTVMDLEAEGTCLRFSPLMTAAGMIS
Remarks:
Gene Accession: BC063633
Add. information Mouse polyclonal antibody raised against a full-length human LOC283970 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn