H00284837-B01P LOC284837 antibody

See related secondary antibodies

Search for all "LOC284837"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC284837

H00284837-B01P

Product Description for LOC284837

Mouse anti Human LOC284837.
Product is tested for Western blot / Immunoblot.

Properties for LOC284837

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC133248
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZR03
Immunogen:
LOC284837 (ENSP00000343338, 1 a.a. ~ 302 a.a) full-length human protein.
AA Sequence:
MPCRLLHQRETRSGGPRGPRHSAPTGPGWHNAPTLQSWEESHAPSRDPRDHQGSVEDTSLGGDAPADGVSPSVPPL QGLGKAAGPGGTGQAECQVVVATHRANLKPWDGRAAPLGKRTEEGRLSTSSCASVSRNKPDSVPQGDPVWPPESTG PALCAGEETEPQSSEGLAWGPWAQPWAPSLCPSQTGTASTASPQRASRLALQGPPGTILSLSSSSPCLPPSHCDPG AASSWAGLQSLKLLLQVSFQGAADGCSLRDANTNRKGPMHGSDFPPRLCLHSMSLWGSWGSRPPSPAHSREVAS
GeneID:
284837
Add. information Mouse polyclonal antibody raised against a full-length human LOC284837 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn