NBP1-70606 LOC339879 antibody

See related secondary antibodies

Search for all "LOC339879"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC339879

Product Description for LOC339879

Rabbit anti Human LOC339879.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC339879

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B0G0Y6
Immunogen:
Synthetic peptides corresponding to LOC339879(hypothetical LOC339879) The peptide sequence was selected from the C terminal of LOC339879. Peptide sequence HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL.
GeneID:
8616454
Background The function remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 3398791

Accessory Products

  • LinkedIn