discontinued

NBP1-70606 LOC339879 antibody

See related secondary antibodies

Search for all "LOC339879"

Quick Overview

Rabbit anti Human LOC339879

Product Description for LOC339879

Rabbit anti Human LOC339879.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC339879

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B0G0Y6
Immunogen:
Synthetic peptides corresponding to LOC339879(hypothetical LOC339879) The peptide sequence was selected from the C terminal of LOC339879. Peptide sequence HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL.
GeneID:
8616454
Background The function remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 3398791

Accessory Products

  • LinkedIn