H00348262-B01P LOC348262 antibody

See related secondary antibodies

Search for all "LOC348262"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC348262

H00348262-B01P

Product Description for LOC348262

Mouse anti Human LOC348262.
Product is tested for Western blot / Immunoblot.

Properties for LOC348262

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms DKFZp686A17165, MGC133184
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
C9JLW8
Immunogen:
LOC348262 (AAI11796.1, 1 a.a. ~ 175 a.a) full-length human protein.
AA Sequence:
MHGEKSHGRGQAGRQVPLKQQSVSGESQQGARQGAGQSTCYLSSAFLCNGSFPAGSMSLWDPQPKQAFPSVLWCSW AGVPGRRTGQRDPRVQERRGDFVSKLGAAVGGEPLALFGPHSWPGMGHRVPGLGAGFLLFAGFALEPWDSYHVVFE GWTIDMRRNEPERTRSLSAPGPL
GeneID:
348262
Add. information Mouse polyclonal antibody raised against a full-length human LOC348262 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn