discontinued

H00389833-B01P LOC389833 antibody

See related secondary antibodies

Search for all "LOC389833"

50 µg / €370.00

Quick Overview

Mouse anti Human LOC389833

H00389833-B01P

Product Description for LOC389833

Mouse anti Human LOC389833.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LOC389833

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ35473, similar to hypothetical protein MGC27019
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC389833 (NP_001028687.1, 1 a.a. ~ 129 a.a) full-length human protein.
AA Sequence:
MFPVSSGCFQEQQETNKSLPRSASTPETRTKFTQDNLCHAQRERLDSANLWVLVDCILRDTSEDLGLQCDAVNLAF GCRCEELEDARHKLQHHLHKMLREITDQEHNVVALKEAIKDKEEPLHIAQTRL
Remarks:
Gene Accession: NM_001033515.1
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
State:
Purified

Accessory Products

  • LinkedIn