H00390748-B01P LOC390748 antibody

See related secondary antibodies

Search for all "LOC390748"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC390748

H00390748-B01P

Product Description for LOC390748

Mouse anti Human LOC390748.
Product is tested for Western blot / Immunoblot.

Properties for LOC390748

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ePABP2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NDY0
Immunogen:
LOC390748 (AAI56596.1, 1 a.a. ~ 289 a.a) full-length human protein.
AA Sequence:
MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEEDQDGDAGFLLSLLEQEN LAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTAAGQLLSPETVGCPLSGTPEEKVEADHRSVYVG NVDYGGSAEELEAHFSRCGEVHRVTILCDKFSGHPKGYAYIEFATKGSVQAAVELDQSLFRGRVIKVLPKRTNFPG ISSTDRGGLRGHPGSRGAPFPHSGLQGRPRLRPQGQNRTPAALTPLWARPLPWVVVSHVIK
GeneID:
390748
Add. information Mouse polyclonal antibody raised against a full-length human LOC390748 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn