H00401010-B01P LOC401010 antibody

See related secondary antibodies

Search for all "LOC401010"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC401010

H00401010-B01P

Product Description for LOC401010

Mouse anti Human LOC401010.
Product is tested for Western blot / Immunoblot.

Properties for LOC401010

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ61647
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC401010 (AAH60851.1, 1 a.a. ~ 742 a.a) full-length human protein.
AA Sequence:
MAGARRRRRRLAELTVDEFLASGFDSKSEYSPEAETREAREAARSPDEPGGSPSASRRKGCASEHKDQLSRLKDRD PEFYKFLQENDQSQLNFSDSDSSEEEEEPFNSLPDVLEEASEDEDGAEEGEDGDRVPRGLKGKNCVPVTLAMVERW KQAAKQHLTPKLFHEVVQAFGAAVATTQGDQEIAEANKFQVTDSAVFNALVTFCIRDLIGCLQKLLFGKAAKDSSR MLQPSSSPLWGKLRVDIKAYLGSVIQLVSCVAETMVLAAVLWHISVLVPCFLTFPKQCRMLLKRMVVVWSTGEESL RVLAFLVLSRVCRHKKDTFLGLVLKQMYIMYVRNCKFTSPGALPFISFMQRTLRELLALEPGVAYQHAFLYIRQLA IHLHNAMTTRKKETSVYNWQYVHCLFLWCRVLSIVGPREALQPLVYSLAQVIIGCIKLIPTARFYPLRMHCIRALT LLSGSSGAFIPVLPFILEMFQQVDFSKKPGCMSSKPINFSVILKLSNVNLQEKAYQDGLVEQLYDLTLEYLHSQAH CIGFPELALPVVLRLKSFLRECKVANYCRQVQQLLGKVQENSEHICSRRQRVSFGVSDQQAVEAWQKLTLEEGTPL TLYYSHWCKLRDWEIQLEISGKERLEDLNFPEIKRRKVADRKDEDRKQFKDLFDLNSCEEDDTEGFLERGILGPLS TRRGVEEDKEDEEEGKEDSSNSEDGDPDAEAGLAPGELQRLAQGPEDELEDLQLSEED
GeneID:
401010
Add. information Mouse polyclonal antibody raised against a full-length human LOC401010 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn