discontinued

H00402176-B01 LOC402176 antibody

See related secondary antibodies

Search for all "LOC402176"

Quick Overview

Mouse anti Human LOC402176

Product Description for LOC402176

Mouse anti Human LOC402176.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LOC402176

Product Category Primary Antibodies
Quantity 50 µl
Synonyms RPL21P44
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC402176 (NP_001011538, 1 a.a. ~ 136 a.a) full-length human protein.
AA Sequence:
MDLFLWLQICESIRKVIWYTSTEWILFKKECPTSVTMAKLKVYSVPQHAVGIVVNKGKILAKRINVHIEHIKHCKS RDSFLKCVKENDQKKKEAKEEGTWVQVKHQPAPPREAHFVKACGKEPELLEPIPCEFMAS
Remarks:
Gene Accession: NM_001011538
Add. information Mouse polyclonal antibody raised against a full-length human LOC402176 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn