H00402176-M03 LOC402176 antibody

See related secondary antibodies

Search for all "LOC402176"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC402176 3E7

H00402176-M03

Product Description for LOC402176

Mouse anti Human LOC402176 3E7.
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for LOC402176

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms -
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 3E7
Host Mouse
Isotype IgG2a
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC402176 (NP_001011538.1, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MDLFLWLQICESIRKVIWYTSTEWILFKKECPTSVTMAKLKVYSVPQHAVGIVVNKGKILAKRINVHIEHIKHCKS RDSFLKCVKENDQKKKEAKEEGTWVQVKHQPAPPREAHFVKACGKEPELLEPIPCEFMAS
GeneID:
402176
Add. information Mouse monoclonal antibody raised against a full-length recombinant LOC402176.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn