discontinued

H00440332-M01 LOC440332 antibody

See related secondary antibodies

Search for all "LOC440332"

0.1 mg / €370.00

Quick Overview

Mouse anti Human LOC440332 1G3

H00440332-M01

Product Description for LOC440332

Mouse anti Human LOC440332 1G3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC440332

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Monoclonal
Clone 1G3
Host Mouse
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC440332 (XP_496112, 253 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN*
Remarks:
Gene Accession: XM_496112
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
State:
Purified

Accessory Products

  • LinkedIn