discontinued

H00440456-B01 LOC440456 antibody

See related secondary antibodies

Search for all "LOC440456"

Quick Overview

Mouse anti Human LOC440456

Product Description for LOC440456

Mouse anti Human LOC440456.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LOC440456

Product Category Primary Antibodies
Quantity 50 µl
Synonyms PLEKHM1P
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC440456 (ENSP00000313104, 1 a.a. ~ 237 a.a) full-length human protein.
AA Sequence:
MTSPRTGTPALDNQPQTGIPRAAGGRDAGTPGQQIPGGEGKGEGGTGEAHPPWAPLATSQRPFRRSLPGSGPRLSA PVLVPMPPKVPSRGIQVPPRPAQTQLLWVWVTALLSVAVPIRCRCQLRFRETSPAPPRKPRPGRWSGPNLPAPPTR PLGSLRPAQQTRGTLDKVAKEPYGSPGLDPAPSVPQPRQAAVSWPLAWVTLGGRRRCGQCGSLEGPCTSGEDHRLM ALVEGRRQI
Remarks:
Gene Accession: XM_942463.1
Add. information Mouse polyclonal antibody raised against a full-length human LOC440456 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn