H00440866-A01 LOC440866 antibody

See related secondary antibodies

Search for all "LOC440866"

50 µl / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human LOC440866

Product Description for LOC440866

Mouse anti Human LOC440866.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for LOC440866

Product Category Primary Antibodies
Quantity 50 µl
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC440866 (XP_496551, 2 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
AA Sequence:
ATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCE YGLTFTEKWNT*
Remarks:
Gene Accession: XM_496551
Add. information Mouse polyclonal antibody raised against a partial recombinant LOC440866.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
Purity:
Antibody Reactive Against Recombinant Protein.
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn