discontinued

H00440866-A01 LOC440866 antibody

See related secondary antibodies

Search for all "LOC440866"

Quick Overview

Mouse anti Human LOC440866

Product Description for LOC440866

Mouse anti Human LOC440866.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for LOC440866

Product Category Primary Antibodies
Quantity 50 µl
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC440866 (XP_496551, 2 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
AA Sequence:
ATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCE YGLTFTEKWNT*
Remarks:
Gene Accession: XM_496551
Add. information Mouse polyclonal antibody raised against a partial recombinant LOC440866.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
Purity:
Antibody Reactive Against Recombinant Protein.
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn