
TA338907 LOC441956 antibody

See related secondary antibodies

Search for all "LOC441956"

Quick Overview

Rabbit anti Human LOC441956

Product Description for LOC441956

Rabbit anti Human LOC441956.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC441956

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-LOC441956 antibody: synthetic peptide directed towards the N terminal of human LOC441956. Synthetic peptide located within the following region: APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK.
Application WB
Background The exact function of LOC441956 remains unknown.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn