discontinued

H00494141-B01P LOC494141 antibody

See related secondary antibodies

Search for all "LOC494141"

Quick Overview

Mouse anti Human LOC494141

Product Description for LOC494141

Mouse anti Human LOC494141.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for LOC494141

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -, similar to mitochondrial carrier triple repeat 1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC494141 (AAH56262.1, 1 a.a. ~ 154 a.a) full-length human protein.
AA Sequence:
MKKEELKQHDGFRSSWKETTNTNIFETRYVTSYYRFSEMKHYLCGCCAAFNNVAITFLIQKVLFPQQLYGIKTGDA ILQLRTDGFRNLYRGIFPRLMQKTTTLALTFGLYEDLSYLLHKHVSAPEFATCGVAAVLAGTTEAIFTSDIASRPQ AP
Remarks:
Gene Accession: BC056262
Add. information Mouse polyclonal antibody raised against a full-length human LOC494141 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn