H00541473-D01P LOC541473 antibody

See related secondary antibodies

Search for all "LOC541473"

0.1 mg / €380.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC541473

H00541473-D01P

Product Description for LOC541473

Rabbit anti Human LOC541473.
Product is tested for Western blot / Immunoblot.

Properties for LOC541473

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms MGC88170
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
LOC541473 (NP_001013770.1, 1 a.a. ~ 131 a.a) full-length human protein.
AA Sequence:
MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNY FRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS
GeneID:
541473
Add. information Rabbit polyclonal antibody raised against a full-length human LOC541473 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn