discontinued

NBP1-88107 LOC619207 scavenger receptor protein family member antibody

See related secondary antibodies

Search for all "LOC619207 scavenger receptor protein family member"

Quick Overview

Rabbit anti Human LOC619207 scavenger receptor protein family member

NBP1-88107

More Views

  • NBP1-88107

Product Description for LOC619207 scavenger receptor protein family member

Rabbit anti Human LOC619207 scavenger receptor protein family member.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for LOC619207 scavenger receptor protein family member

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2AUW2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VEEAMVFCRELGCGPVLQAPRRDVGVVRKYLACRGTEPTIRSCRLDNNFRSGCDLRLDAEVVC
GeneID:
6192070
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 6192070

Accessory Products

  • LinkedIn