
NBP1-70608 LOC641515 antibody

See related secondary antibodies

Search for all "LOC641515"

50 µg / €440.00

Quick Overview

Rabbit anti Human LOC641515

Product Description for LOC641515

Rabbit anti Human LOC641515.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC641515

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC641515(hypothetical protein LOC641515) The peptide sequence was selected from the C terminal of LOC641515. Peptide sequence FWTHNISIGNHLTVILNHPANLSRVQVMTGSIVEWEVRPGEGAGGAGLPT.
Background The exact function of LOC641515 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6415150

Accessory Products

  • LinkedIn