NBP1-70608 LOC641515 antibody

See related secondary antibodies

Search for all "LOC641515"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC641515

Product Description for LOC641515

Rabbit anti Human LOC641515.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC641515

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3PD10
Immunogen:
Synthetic peptides corresponding to LOC641515(hypothetical protein LOC641515) The peptide sequence was selected from the C terminal of LOC641515. Peptide sequence FWTHNISIGNHLTVILNHPANLSRVQVMTGSIVEWEVRPGEGAGGAGLPT.
GeneID:
6415150
Background The exact function of LOC641515 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6415150

Accessory Products

  • LinkedIn