NBP1-70609 LOC642097 antibody

See related secondary antibodies

Search for all "LOC642097"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC642097

Product Description for LOC642097

Rabbit anti Human LOC642097.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC642097

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC642097 The peptide sequence was selected from the N terminal of LOC642097. Peptide sequence MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL.
Background The exact function of LOC642097 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6420970

Accessory Products

  • LinkedIn