NBP1-70612 LOC645015 antibody

See related secondary antibodies

Search for all "LOC645015"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC645015

Product Description for LOC645015

Rabbit anti Human LOC645015.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC645015

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC645015(similar to mannosyltransferase) The peptide sequence was selected from the middle region of LOC645015. Peptide sequence LPSLVCVITGQGPLTEYYSRPIHQKHFQHIQVCNPWLEAEDYPLLLGSVD.
Background The exact function of LOC645015 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6450150

Accessory Products

  • LinkedIn