
NBP1-70613 LOC645015 antibody

See related secondary antibodies

Search for all "LOC645015"

50 µg / €440.00

Quick Overview

Rabbit anti Human LOC645015

Product Description for LOC645015

Rabbit anti Human LOC645015.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC645015

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC645015(similar to mannosyltransferase) The peptide sequence was selected from the N terminal of LOC645015. Peptide sequence HLCGTLACRPPSICCMLLTSRVATQTAIQTYQENPQASPEVPVLLGPCEP.
Background The exact function of LOC645015 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6450150

Accessory Products

  • LinkedIn