discontinued

NBP1-70615 LOC650515 antibody

See related secondary antibodies

Search for all "LOC650515"

50 µg / €440.00

Quick Overview

Rabbit anti Human LOC650515

Product Description for LOC650515

Rabbit anti Human LOC650515.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC650515

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3MWH5
Immunogen:
Synthetic peptides corresponding to LOC650515(similar to beta-1,4-mannosyltransferase) The peptide sequence was selected from the C terminal of LOC650515. Peptide sequence VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI.
GeneID:
6505150
Background The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6505150

Accessory Products

  • LinkedIn