NBP1-70616 LOC652559 antibody

See related secondary antibodies

Search for all "LOC652559"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LOC652559

Product Description for LOC652559

Rabbit anti Human LOC652559.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC652559

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to LOC652559 The peptide sequence was selected from the middle region of LOC652559. Peptide sequence EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL.
Background The sequence of LOC652559 is derived from an annotated genomic sequence (NW_922352) using gene prediction method: GNOMON. The exact function of LOC652559 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 6525590

Accessory Products

  • LinkedIn