discontinued

NBP1-70616 LOC652559 antibody

See related secondary antibodies

Search for all "LOC652559"

Quick Overview

Rabbit anti Human LOC652559

Product Description for LOC652559

Rabbit anti Human LOC652559.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC652559

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4Q1V8
Immunogen:
Synthetic peptides corresponding to LOC652559 The peptide sequence was selected from the middle region of LOC652559. Peptide sequence EKSKLGEVDHTLDLVVSFIQEQIVTEEAKSKNSGDAGVDRSLRGPYLARL.
GeneID:
6525590
Background The sequence of LOC652559 is derived from an annotated genomic sequence (NW_922352) using gene prediction method: GNOMON. The exact function of LOC652559 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6525590

Accessory Products

  • LinkedIn