discontinued

NBP1-70617 LOC652618 antibody

See related secondary antibodies

Search for all "LOC652618"

Quick Overview

Rabbit anti Human LOC652618

Product Description for LOC652618

Rabbit anti Human LOC652618.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LOC652618

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4PZ37
Immunogen:
Synthetic peptides corresponding to LOC652618 The peptide sequence was selected from the N terminal of LOC652618. Peptide sequence MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKV.
GeneID:
6526180
Background The exact function of LOC652618 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 6526180

Accessory Products

  • LinkedIn